Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LOC100364462 Peptide - middle region

LOC100364462 Peptide - middle region

Product Specifications

Product Name Alternative

LOC100364462

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

XP_002724704

Preservative

Lyophilized powder

AA Sequence

LIPLHAAPNQAVAEIDALYDVYLDVIDKWNTDDMLFLGDFNADCKYVKAH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MEF2A pThr312 Rabbit Polyclonal Antibody
AP01632PU-N 100 µg

MEF2A pThr312 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD4 (C4/206), CF568 conjugate, 0.1mg/mL
BNC680206-100 1x 100 µL

CD4 (C4/206), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
hHR23b (RAD23B) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI9F8]
TA804863BM 100 µL

hHR23b (RAD23B) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI9F8]

Sign In for Pricing
View Details
HSP27 (HSPB1/774), CF647 conjugate, 0.1mg/mL
BNC470774-100 1x 100 µL

HSP27 (HSPB1/774), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
RUVBL2 Rabbit Polyclonal Antibody
TA370206 100 µL

RUVBL2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human SAMSN1 activation kit by CRISPRa
GA111967 1 Kit

Human SAMSN1 activation kit by CRISPRa

Sign In for Pricing
View Details