Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CXorf67 Peptide - middle region

CXorf67 Peptide - middle region

Product Specifications

Product Name Alternative

MGC47837

UniProt

Q86X51

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CXorf67 Rabbit Polyclonal Antibody (orb582954) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_981952

Preservative

Lyophilized powder

AA Sequence

RRSLSGSADENPSCGTGSERLAFQSRSGSPDPEVPSRASPPVWHAVRMRA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-CK2 beta (pS209) Antibody
YLD1918-01 50 µL

Rabbit anti-CK2 beta (pS209) Antibody

Sign In for Pricing
View Details
Rabbit anti-CK2 beta (pS209) Antibody
YLD1918-02 100 µL

Rabbit anti-CK2 beta (pS209) Antibody

Sign In for Pricing
View Details
Rabbit anti-COG2 Antibody
YLD2029-01 50 µL

Rabbit anti-COG2 Antibody

Sign In for Pricing
View Details
Rabbit anti-COG2 Antibody
YLD2029-02 100 µL

Rabbit anti-COG2 Antibody

Sign In for Pricing
View Details
CPEB4 Rabbit Polyclonal Antibody (BF350)
orb2518896 100 µL

CPEB4 Rabbit Polyclonal Antibody (BF350)

Sign In for Pricing
View Details
FFPE Tissue Blocks, Breast
CB554298 1 Block

FFPE Tissue Blocks, Breast

Sign In for Pricing
View Details