CXorf67 Peptide - middle region
CXorf67 Peptide - middle region
Product Specifications
Product Name Alternative
MGC47837
UniProt
Q86X51
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CXorf67 Rabbit Polyclonal Antibody (orb582954) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_981952
Preservative
Lyophilized powder
AA Sequence
RRSLSGSADENPSCGTGSERLAFQSRSGSPDPEVPSRASPPVWHAVRMRA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS9946487 Inquire
Fish Kinetochore Protein Spc25 (SPC25) ELISA Kit
Sign In for Pricing
View Details 
MBS6372761-01 0.1 mL
CD109 (CD109 Antigen, 150kD TGF-beta-1-binding Protein, C3 and PZP-like alpha-2-macroglobulin Domain-containing Protein 7, Platelet-specific Gov Antigen, p180, r150, CPAMD7, DKFZp762L1111, FLJ38569, FLJ41966, RP11-525G3.1) (PE)
Sign In for Pricing
View Details MBS6372761-02 5x 0.1 mL
CD109 (CD109 Antigen, 150kD TGF-beta-1-binding Protein, C3 and PZP-like alpha-2-macroglobulin Domain-containing Protein 7, Platelet-specific Gov Antigen, p180, r150, CPAMD7, DKFZp762L1111, FLJ38569, FLJ41966, RP11-525G3.1) (PE)
Sign In for Pricing
View Details MBS1195967 Inquire
Recombinant Halobacterium salinarum Smc-like protein Sph1 (sph1), partial
Sign In for Pricing
View Details