Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LOC434391 Peptide - N-terminal region

LOC434391 Peptide - N-terminal region

Product Specifications

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

XP_486205

Preservative

Lyophilized powder

AA Sequence

MARSPGTMLRRDALLFGTSTFAFGRLPLCMQSGKHDNNLIHASEWRPPGS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARL2 (NM_001667) Human Over-expression Lysate
LC419817 20 µg

ARL2 (NM_001667) Human Over-expression Lysate

Sign In for Pricing
View Details
GelGreen® Agarose LE
#41030-50G 1x 50 g

GelGreen® Agarose LE

Sign In for Pricing
View Details
DHX29 (NM_019030) Human Recombinant Protein
TP308227M 100 µg

DHX29 (NM_019030) Human Recombinant Protein

Sign In for Pricing
View Details
Clarin 2 (CLRN2) (NM_001079827) Human Over-expression Lysate
LY421552 100 µg

Clarin 2 (CLRN2) (NM_001079827) Human Over-expression Lysate

Sign In for Pricing
View Details
STK3 (NM_006281) Human Over-expression Lysate
LC401892 20 µg

STK3 (NM_006281) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue FFPE Sections, Uterus
CS704408 5x 5 µm

Tissue FFPE Sections, Uterus

Sign In for Pricing
View Details