Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LOC434391 Peptide - N-terminal region

LOC434391 Peptide - N-terminal region

Product Specifications

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

XP_486205

Preservative

Lyophilized powder

AA Sequence

MARSPGTMLRRDALLFGTSTFAFGRLPLCMQSGKHDNNLIHASEWRPPGS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pellino 1 (PELI1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3A9]
TA807607AM 100 µL

Pellino 1 (PELI1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3A9]

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon: sigmoid
CS643996 5x 5 µm

Frozen Tissue Sections, Colon: sigmoid

Sign In for Pricing
View Details
EGFR pSer1046 Rabbit Polyclonal Antibody
AP01890PU-N 100 µg

EGFR pSer1046 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TNK1 Mouse Monoclonal Antibody [Clone ID: 1B5G3]
AM06239SU-N 100 µL

TNK1 Mouse Monoclonal Antibody [Clone ID: 1B5G3]

Sign In for Pricing
View Details
CD269 / TNFRSF17 / BCMA (B-Cell Maturation Protein) (BCMA/2366), CF640R conjugate, 0.1mg/mL
BNC402366-500 1x 500 µL

CD269 / TNFRSF17 / BCMA (B-Cell Maturation Protein) (BCMA/2366), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Desmin (Muscle Cell Marker) (D33), CF488A conjugate, 0.1mg/mL
BNC881722-100 1x 100 µL

Desmin (Muscle Cell Marker) (D33), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details