What is the catalog number for LOC441253 Peptide - middle region?

The catalog number for LOC441253 Peptide - middle region is orb2010100.

What sizes are available for LOC441253 Peptide - middle region?

LOC441253 Peptide - middle region is available in the following size(s): 100 µg.

Is LOC441253 Peptide - middle region in stock?

LOC441253 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

LOC441253 Peptide - middle region

Product Specifications

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

XP_379877

Preservative

Lyophilized powder

AA Sequence

EQQKMNTLQGPVSFKDVAVDFTQEEWRQLDPDEKITYGDVMLENYSHLVS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

abx455166-01 50 µg

Sodium/Calcium Exchanger 1 (SLC8A1) Antibody

Sign In for Pricing

View Details

abx455166-02 100 µg

Sodium/Calcium Exchanger 1 (SLC8A1) Antibody

Sign In for Pricing

View Details

MBS9941968 Inquire

Donkey UTP--Glucose-1-Phosphate Uridylyltransferase (UGP2) ELISA Kit

Sign In for Pricing

View Details

143721 96 Tests

B7-1/CD80 BioAssayTM ELISA Kit, Mouse

Sign In for Pricing

View Details

NBP2-12423AF405 0.1 mL

Rat Monoclonal Cathepsin 6 Antibody (RM0157-3L27) [Alexa Fluor 405]

Sign In for Pricing

View Details

sc-421410-NIC 20 µg

LECT2 Double Nickase Plasmid (m)

Sign In for Pricing

View Details