Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDLIM1 Peptide - middle region

PDLIM1 Peptide - middle region

Product Specifications

Product Name Alternative

CLP36, Clim1, mClim1

UniProt

O70400

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PDLIM1 Rabbit Polyclonal Antibody (orb324734) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_058557.2

Preservative

Lyophilized powder

AA Sequence

ISNFNNAVESKTSASGKEANSRPLVQPHPSGSLIIDKESEVYKMLQEKQE

More Discoveries

Explore Other Products

Browse additional items from our catalog

ENPP3 Rabbit Polyclonal Antibody (Biotin)
orb447815 100 µL

ENPP3 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
MICAL2 Antibody Blocking peptide
orb1444032 500 µg

MICAL2 Antibody Blocking peptide

Sign In for Pricing
View Details
Human S100 Calcium Binding Protein A11 (Recombinant)
22060475-1 2 µg

Human S100 Calcium Binding Protein A11 (Recombinant)

Sign In for Pricing
View Details
Rabbit Polyclonal Calsequestrin 1 Antibody [mFluor Violet 450 SE]
NBP3-00194MFV450 0.1 mL

Rabbit Polyclonal Calsequestrin 1 Antibody [mFluor Violet 450 SE]

Sign In for Pricing
View Details
TKTL2 Peptide
MBS3234224-01 0.1 mg

TKTL2 Peptide

Sign In for Pricing
View Details
TKTL2 Peptide
MBS3234224-02 5x 0.1 mg

TKTL2 Peptide

Sign In for Pricing
View Details