Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDLIM1 Peptide - middle region

PDLIM1 Peptide - middle region

Product Specifications

Product Name Alternative

CLP36, Clim1, mClim1

UniProt

O70400

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PDLIM1 Rabbit Polyclonal Antibody (orb324734) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_058557.2

Preservative

Lyophilized powder

AA Sequence

ISNFNNAVESKTSASGKEANSRPLVQPHPSGSLIIDKESEVYKMLQEKQE

More Discoveries

Explore Other Products

Browse additional items from our catalog

Valosin Peptide (Porcine)
CCP2978-01 1 mg

Valosin Peptide (Porcine)

Sign In for Pricing
View Details
Valosin Peptide (Porcine)
CCP2978-02 5 mg

Valosin Peptide (Porcine)

Sign In for Pricing
View Details
Valosin Peptide (Porcine)
CCP2978-03 10 mg

Valosin Peptide (Porcine)

Sign In for Pricing
View Details
Recombinant Bordetella Avium hfq Protein (aa 1-78)
VAng-Lsx4015-500gEcoli 500 µg (E. coli)

Recombinant Bordetella Avium hfq Protein (aa 1-78)

Sign In for Pricing
View Details
Hmbox1 Rabbit Polyclonal Antibody
TA355618 100 µL

Hmbox1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
BC125332 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
13198064 1.0 µg DNA

BC125332 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details