Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZBED8 Peptide - N-terminal region

ZBED8 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Buster3, C5orf54

UniProt

Q8IZ13

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZBED8 Rabbit Polyclonal Antibody (orb583624) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_071373

Preservative

Lyophilized powder

AA Sequence

SVFSNADLRPSKLSDHFNRQHGGVAGHDLNSLKHMPAPSDQSETLKAFGV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Regulator of G-protein signaling 19, RGS19 ELISA Kit
MBS9330387-01 48 Well

Bovine Regulator of G-protein signaling 19, RGS19 ELISA Kit

Sign In for Pricing
View Details
Bovine Regulator of G-protein signaling 19, RGS19 ELISA Kit
MBS9330387-02 96 Well

Bovine Regulator of G-protein signaling 19, RGS19 ELISA Kit

Sign In for Pricing
View Details
Bovine Regulator of G-protein signaling 19, RGS19 ELISA Kit
MBS9330387-03 5x 96 Well

Bovine Regulator of G-protein signaling 19, RGS19 ELISA Kit

Sign In for Pricing
View Details
Bovine Regulator of G-protein signaling 19, RGS19 ELISA Kit
MBS9330387-04 10x 96 Well

Bovine Regulator of G-protein signaling 19, RGS19 ELISA Kit

Sign In for Pricing
View Details
NME4 (Non-Metastatic Cells 4, Protein Expressed in, NDPK-D, NM23H4, nm23-H4) (APC)
MBS6170352-01 0.1 mL

NME4 (Non-Metastatic Cells 4, Protein Expressed in, NDPK-D, NM23H4, nm23-H4) (APC)

Sign In for Pricing
View Details
NME4 (Non-Metastatic Cells 4, Protein Expressed in, NDPK-D, NM23H4, nm23-H4) (APC)
MBS6170352-02 5x 0.1 mL

NME4 (Non-Metastatic Cells 4, Protein Expressed in, NDPK-D, NM23H4, nm23-H4) (APC)

Sign In for Pricing
View Details