LOC640502 Peptide - C-terminal region
LOC640502 Peptide - C-terminal region
Product Specifications
Product Name Alternative
AgX, AGX1, AGX-1, AGX-2, SPAG2, ESTM38, AA420407, AA437972
UniProt
Q91YN5
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Tested Applications
WB
NCBI Accession Number
C8TKD8AJ016, 68566143, 15, Q91YN5.1
Preservative
Lyophilized powder
AA Sequence
EDEFSPLKNADSQNGKDNPTTARHALMSLHHCWVLNAGGHFIDENGSRLP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC041429-100 1x 100 µL
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740204-500 1x 500 µL
Complement C4d (C4D204), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040181-500 1x 500 µL
CD59 (heavy chain of Protectin) (BRA-10G), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400008-100 1x 100 µL
MAGE A1 (MA454), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 