What is the catalog number for ATF4P3 Peptide - middle region?

The catalog number for ATF4P3 Peptide - middle region is orb2010095.

What sizes are available for ATF4P3 Peptide - middle region?

ATF4P3 Peptide - middle region is available in the following size(s): 100 µg.

Is ATF4P3 Peptide - middle region in stock?

ATF4P3 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

ATF4P3 Peptide - middle region

Product Specifications

Product Name Alternative

ATF4C

UniProt

P18848

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

XP_933730

Preservative

Lyophilized powder

AA Sequence

SDNDSGICMSPESYLGSPQHSPSTRGSPNRSLPSPGVLCGSAHPKPYDPP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RM-P680301-01 10 mg

Pirarubicin Impurity 1

Sign In for Pricing

View Details

RM-P680301-02 25 mg

Pirarubicin Impurity 1

Sign In for Pricing

View Details

RM-P680301-03 50 mg

Pirarubicin Impurity 1

Sign In for Pricing

View Details

RM-P680301-04 100 mg

Pirarubicin Impurity 1

Sign In for Pricing

View Details

GTR15384088 1 Vial

Lentiviral human ZNF660-ZNF197 sgRNA gene knockout kit - Lentiviral human ZNF660-ZNF197 sgRNA gene knockout kit (100)

Sign In for Pricing

View Details

NB100-63779V 0.1 mL

Mouse Monoclonal Integrin alpha 2b/CD41 Antibody (PM6/248) [DyLight 405]

Sign In for Pricing

View Details