Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SNRPD2P2 Peptide - middle region

SNRPD2P2 Peptide - middle region

Product Specifications

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

XP_001727019

Preservative

Lyophilized powder

AA Sequence

MVLENVKEMCTEVPKGGNGGKGKKKSKPANKDHFISKLFLCRDSVITNKW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vertical Laminar Airflow BLVR-304
BLVR-304 1 Unit

Vertical Laminar Airflow BLVR-304

Sign In for Pricing
View Details
ZAP70 (ZAP70/528), CF647 conjugate, 0.1mg/mL
BNC470528-500 1x 500 µL

ZAP70 (ZAP70/528), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant ACRV1 Antibody
RC-15861-01 50 μL

Recombinant ACRV1 Antibody

Sign In for Pricing
View Details
Recombinant ACRV1 Antibody
RC-15861-02 100 µL

Recombinant ACRV1 Antibody

Sign In for Pricing
View Details
Recombinant ACRV1 Antibody
RC-15861-03 1 mL

Recombinant ACRV1 Antibody

Sign In for Pricing
View Details
S100A4 (Marker of Tumor Metastasis) (S100A4/1482), CF640R conjugate, 0.1mg/mL
BNC401482-500 1x 500 µL

S100A4 (Marker of Tumor Metastasis) (S100A4/1482), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details