Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SNRPD2P2 Peptide - middle region

SNRPD2P2 Peptide - middle region

Product Specifications

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

XP_001727019

Preservative

Lyophilized powder

AA Sequence

MVLENVKEMCTEVPKGGNGGKGKKKSKPANKDHFISKLFLCRDSVITNKW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD35 / CR1 (Follicular Dendritic Cell Marker) (To5), CF568 conjugate, 0.1mg/mL
BNC681318-500 1x 500 µL

CD35 / CR1 (Follicular Dendritic Cell Marker) (To5), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SCP2D1-AS1 Human Gene Knockout Kit (CRISPR)
KN433316 1 Kit

SCP2D1-AS1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GlycoLinerTM 650/670 Cell Surface Glycoprotein Labeling Kit, 500 Labelings
#30146 1 Kit

GlycoLinerTM 650/670 Cell Surface Glycoprotein Labeling Kit, 500 Labelings

Sign In for Pricing
View Details
HIP1 Antibody
KC-10450-01 50 μL

HIP1 Antibody

Sign In for Pricing
View Details
HIP1 Antibody
KC-10450-02 100 µL

HIP1 Antibody

Sign In for Pricing
View Details
HIP1 Antibody
KC-10450-03 1 mL

HIP1 Antibody

Sign In for Pricing
View Details