Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LOH11CR2A Peptide - N-terminal region

LOH11CR2A Peptide - N-terminal region

Product Specifications

Product Name Alternative

BCSC-1, BCSC1, LOH11CR2A

UniProt

O00534

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LOH11CR2A Rabbit Polyclonal Antibody (orb325960) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055437

Preservative

Lyophilized powder

AA Sequence

TLSMVATIDSQHGIEKVQSNCPLSPTEYLGEDKTSAQVSLAAGHKFDRDV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P27 / KIP1 (SX53G8), CF488A conjugate, 0.1mg/mL
BNC880669-500 1x 500 µL

P27 / KIP1 (SX53G8), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF488A conjugate, 0.1mg/mL
BNC881050-500 1x 500 µL

CD3e (CRIS-7), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC2 (CCP58), CF740 conjugate, 0.1mg/mL
BNC740032-500 1x 500 µL

MUC2 (CCP58), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF594 conjugate, 0.1mg/mL
BNC941050-100 1x 100 µL

CD3e (CRIS-7), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Myosin, Smooth Muscle Heavy Chain (MYH11/923), CF488A conjugate, 0.1mg/mL
BNC880923-500 1x 500 µL

Myosin, Smooth Muscle Heavy Chain (MYH11/923), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Moesin (rMSN/492), CF405S conjugate, 0.1mg/mL
BNC042307-100 1x 100 µL

Moesin (rMSN/492), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details