Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Loxl2 Peptide - C-terminal region

Loxl2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

1110004B06Rik, 4930526G11Rik, 9430067E15Rik, MGC102220

UniProt

P58022

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Loxl2 Rabbit Polyclonal Antibody (orb582438) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_201582

Preservative

Lyophilized powder

AA Sequence

NNGQSDFRPKNGRHAWIWHDCHRHYHSMEVFTYYDLLSLNGTKVAEGHKA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADH5 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4D4]
TA809482BM 100 µL

ADH5 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4D4]

Sign In for Pricing
View Details
PE Anti-Mouse CD115 Antibody
DL21296F-01 25 μg

PE Anti-Mouse CD115 Antibody

Sign In for Pricing
View Details
PE Anti-Mouse CD115 Antibody
DL21296F-02 50 μg

PE Anti-Mouse CD115 Antibody

Sign In for Pricing
View Details
PE Anti-Mouse CD115 Antibody
DL21296F-03 100 μg

PE Anti-Mouse CD115 Antibody

Sign In for Pricing
View Details
PE Anti-Mouse CD115 Antibody
DL21296F-04 200 μg

PE Anti-Mouse CD115 Antibody

Sign In for Pricing
View Details
UBR5 Recombinant Antibody, Cy5 Conjugated
bsm-62223R-Cy5 100 µL

UBR5 Recombinant Antibody, Cy5 Conjugated

Sign In for Pricing
View Details