Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LOXL3 Peptide - middle region

LOXL3 Peptide - middle region

Product Specifications

Product Name Alternative

LOXL

UniProt

P58215

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LOXL3 Rabbit Polyclonal Antibody (orb584630) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115992

Preservative

Lyophilized powder

AA Sequence

AASSGQKKQQQSKPQGEARVRLKGGAHPGEGRVEVLKASTWGTVCDRKWD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCK1 (NM_002591) Human Tagged Lenti ORF Clone
RC204758L1 10 µg

PCK1 (NM_002591) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Recombinant Human ANP32A Protein, His, E.coli-2ug
QP11026-2ug 2ug

Recombinant Human ANP32A Protein, His, E.coli-2ug

Sign In for Pricing
View Details
OR9Q2 sgRNA CRISPR Lentivector (Human) (Target 3)
K1549104 1.0 µg DNA

OR9Q2 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
ACAD8, ID (ACAD8, ARC42, IBD, Isobutyryl-CoA dehydrogenase, mitochondrial, Activator-recruited cofactor 42kD component, Acyl-CoA dehydrogenase family member 8) (AP) discontinued
031518-AP 200 µL

ACAD8, ID (ACAD8, ARC42, IBD, Isobutyryl-CoA dehydrogenase, mitochondrial, Activator-recruited cofactor 42kD component, Acyl-CoA dehydrogenase family member 8) (AP) discontinued

Sign In for Pricing
View Details
Hepatitis A Virus, VP1, Recombinant (HAV)
MBS636944-01 0.1 mg

Hepatitis A Virus, VP1, Recombinant (HAV)

Sign In for Pricing
View Details
Hepatitis A Virus, VP1, Recombinant (HAV)
MBS636944-02 0.5 mg

Hepatitis A Virus, VP1, Recombinant (HAV)

Sign In for Pricing
View Details