Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LOXL3 Peptide - middle region

LOXL3 Peptide - middle region

Product Specifications

Product Name Alternative

LOXL

UniProt

P58215

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LOXL3 Rabbit Polyclonal Antibody (orb584630) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115992

Preservative

Lyophilized powder

AA Sequence

AASSGQKKQQQSKPQGEARVRLKGGAHPGEGRVEVLKASTWGTVCDRKWD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SMTNL2 Antibody / Smoothelin-like protein 2
RQ8720 100 µg

SMTNL2 Antibody / Smoothelin-like protein 2

Sign In for Pricing
View Details
Rfx3 3'UTR Luciferase Stable Cell Line
TU117766 1.0 mL

Rfx3 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Profilin-4, 1-129aa, Human, His tag, E Coli
MBS203434-01 0.02 mg

Profilin-4, 1-129aa, Human, His tag, E Coli

Sign In for Pricing
View Details
Profilin-4, 1-129aa, Human, His tag, E Coli
MBS203434-02 0.1 mg

Profilin-4, 1-129aa, Human, His tag, E Coli

Sign In for Pricing
View Details
Profilin-4, 1-129aa, Human, His tag, E Coli
MBS203434-03 5x 0.02 mg

Profilin-4, 1-129aa, Human, His tag, E Coli

Sign In for Pricing
View Details
Profilin-4, 1-129aa, Human, His tag, E Coli
MBS203434-04 0.5 mg

Profilin-4, 1-129aa, Human, His tag, E Coli

Sign In for Pricing
View Details