Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LPA Peptide - N-terminal region

LPA Peptide - N-terminal region

Product Specifications

Product Name Alternative

LP, AK38, APOA, LPA

UniProt

P08519

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LPA Rabbit Polyclonal Antibody (orb326333) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

EAW47596

Preservative

Lyophilized powder

AA Sequence

VPDPSTEASSEEAPTEQSPGVQDCYHGDGQSYRGSFSTTVTGRTCQSWSS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Colloidal Gold Conjugated Monoclonal Antibody to Human IgG,  40nm
GM-07-40 1 mL

Colloidal Gold Conjugated Monoclonal Antibody to Human IgG, 40nm

Sign In for Pricing
View Details
Calponin-1 (Smooth Muscle Marker), CF647 conjugate, 0.1mg/mL
BNC471685-500 1x 500 µL

Calponin-1 (Smooth Muscle Marker), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HOMER2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2E10]
TA806312AM 100 µL

HOMER2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2E10]

Sign In for Pricing
View Details
DGCR2 (NM_001184781) Human Over-expression Lysate
LY433256 100 µg

DGCR2 (NM_001184781) Human Over-expression Lysate

Sign In for Pricing
View Details
Cytochrome C Oxidase subunit VIb (COX6B1) Human Gene Knockout Kit (CRISPR)
KN400957 1 Kit

Cytochrome C Oxidase subunit VIb (COX6B1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
IL33 Antibody (HRP)
KH-2675-01 50 μL

IL33 Antibody (HRP)

Sign In for Pricing
View Details