Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LPA Peptide - N-terminal region

LPA Peptide - N-terminal region

Product Specifications

Product Name Alternative

LP, AK38, APOA, LPA

UniProt

P08519

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LPA Rabbit Polyclonal Antibody (orb326333) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

EAW47596

Preservative

Lyophilized powder

AA Sequence

VPDPSTEASSEEAPTEQSPGVQDCYHGDGQSYRGSFSTTVTGRTCQSWSS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CYP1B1 Human Gene Knockout Kit (CRISPR)
KN204074RB 1 Kit

CYP1B1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Laboratory Refrigerator BLAR-401
BLAR-401 Each

Laboratory Refrigerator BLAR-401

Sign In for Pricing
View Details
NUDT21 Mouse Monoclonal Antibody [Clone ID: OTI2C8]
CF805829 100 µg

NUDT21 Mouse Monoclonal Antibody [Clone ID: OTI2C8]

Sign In for Pricing
View Details
MED15 Mouse Monoclonal Antibody [Clone ID: OTI3F1]
CF807906 100 µg

MED15 Mouse Monoclonal Antibody [Clone ID: OTI3F1]

Sign In for Pricing
View Details
Mouse IL-2, C-His, Flag Tag
HA210653-01 20 µg

Mouse IL-2, C-His, Flag Tag

Sign In for Pricing
View Details
Mouse IL-2, C-His, Flag Tag
HA210653-02 50 µg

Mouse IL-2, C-His, Flag Tag

Sign In for Pricing
View Details