Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lpcat2 Peptide - C-terminal region

Lpcat2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

A330042H22, Aytl1, LPCAT2, lpafat1, Aytl1a

UniProt

Q8BYI6

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Lpcat2 Rabbit Polyclonal Antibody (orb580022) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_766602

Preservative

Lyophilized powder

AA Sequence

LGVPDLNVSGLFREIAQRDSVSYEEFKSFALKHPEYAKIFTTYLDLQTCH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Agaricus bisporus Polyphenol oxidase 2 (PPO2)
RPC28708-01 20 µg

Recombinant Agaricus bisporus Polyphenol oxidase 2 (PPO2)

Sign In for Pricing
View Details
Recombinant Agaricus bisporus Polyphenol oxidase 2 (PPO2)
RPC28708-02 100 µg

Recombinant Agaricus bisporus Polyphenol oxidase 2 (PPO2)

Sign In for Pricing
View Details
Recombinant Agaricus bisporus Polyphenol oxidase 2 (PPO2)
RPC28708-03 1 mg

Recombinant Agaricus bisporus Polyphenol oxidase 2 (PPO2)

Sign In for Pricing
View Details
Anti-ZIKV Envelope protein E Polyclonal Antibody
VK740014-01 50 µg

Anti-ZIKV Envelope protein E Polyclonal Antibody

Sign In for Pricing
View Details
Anti-ZIKV Envelope protein E Polyclonal Antibody
VK740014-02 100 µg

Anti-ZIKV Envelope protein E Polyclonal Antibody

Sign In for Pricing
View Details
ACTG1P9 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV757093 1.0 µg DNA

ACTG1P9 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details