Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lpcat2 Peptide - C-terminal region

Lpcat2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

A330042H22, Aytl1, LPCAT2, lpafat1, Aytl1a

UniProt

Q8BYI6

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Lpcat2 Rabbit Polyclonal Antibody (orb580022) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_766602

Preservative

Lyophilized powder

AA Sequence

LGVPDLNVSGLFREIAQRDSVSYEEFKSFALKHPEYAKIFTTYLDLQTCH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Slc44a4 (NM_023557) Mouse Untagged Clone
MC220659 10 µg

Slc44a4 (NM_023557) Mouse Untagged Clone

Sign In for Pricing
View Details
5' JOE / 3' TAMRA
FP-104-50 50 to 70 nmol

5' JOE / 3' TAMRA

Sign In for Pricing
View Details
Spic (NM_011461) Mouse Tagged ORF Clone
MR203000 10 µg

Spic (NM_011461) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
BIOPHEN Factor IX (small)
221801 2x 20 Tests

BIOPHEN Factor IX (small)

Sign In for Pricing
View Details
Human THBS1 Knockout A549 cell line
GTR15416192 1 Vial

Human THBS1 Knockout A549 cell line

Sign In for Pricing
View Details
NKX1-2 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
31877154 3x 1.0 µg DNA

NKX1-2 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details