Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lpcat2 Peptide - N-terminal region

Lpcat2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

A330042H22, Aytl1, LPCAT2, lpafat1, Aytl1a

UniProt

Q8BYI6

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Lpcat2 Rabbit Polyclonal Antibody (orb580023) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_766602

Preservative

Lyophilized powder

AA Sequence

NENAQTPLVGRLLRALQPVLVSRVDPDSRKNTINEIKKRATSGGEWPQIL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HRG ELISA Kit (Rat) (OKCD02545)
OKCD02545 96 Well

HRG ELISA Kit (Rat) (OKCD02545)

Sign In for Pricing
View Details
APBB3 Rabbit Polyclonal Antibody (PerCP)
orb2542376 100 µL

APBB3 Rabbit Polyclonal Antibody (PerCP)

Sign In for Pricing
View Details
Activin receptor type-1 Recombinant Antibody, APC-Cy5.5 Conjugated
bsm-62407R-APC-Cy5.5 100 µL

Activin receptor type-1 Recombinant Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details
Epsin 1 Rabbit Monoclonal Antibody
E10G21363 100 µL

Epsin 1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Z-Phe (4-Br) -OH
CSB-DT2130 1 g

Z-Phe (4-Br) -OH

Sign In for Pricing
View Details
Bovine CXCL10 (IP-10) ELISA
DIY0662B-01 1 Pack (10 Plates)

Bovine CXCL10 (IP-10) ELISA

Sign In for Pricing
View Details