Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LPIN2 Peptide - C-terminal region

LPIN2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

KIAA0249

UniProt

Q92539

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LPIN2 Rabbit Polyclonal Antibody (orb331140) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055461

Preservative

Lyophilized powder

AA Sequence

ELIQERTKGNKSSYHRLSELVEHVFPLLSKEQNSAFPCPEFSSFCYWRDP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Befunolol-d7
442204 2.5 mg

Befunolol-d7

Sign In for Pricing
View Details
Cxcr2 Mouse qPCR Primer Pair (NM_009909)
MP206804 200 Reactions

Cxcr2 Mouse qPCR Primer Pair (NM_009909)

Sign In for Pricing
View Details
RRP8 (NM_015324) Human Tagged ORF Clone Lentiviral Particle
RC200844L4V 200 µL

RRP8 (NM_015324) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Pax-7 shRNA (h2) Lentiviral Particles
sc-43997-V 200 µL

Pax-7 shRNA (h2) Lentiviral Particles

Sign In for Pricing
View Details
NFκB-p100/p52 (Ab-871) Antibody
E021297-1 50 µg - 50 µL

NFκB-p100/p52 (Ab-871) Antibody

Sign In for Pricing
View Details
Rnf6 (NM_028774) Mouse Tagged Lenti ORF Clone
MR222458L4 10 µg

Rnf6 (NM_028774) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details