Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LPIN2 Peptide - C-terminal region

LPIN2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

KIAA0249

UniProt

Q92539

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LPIN2 Rabbit Polyclonal Antibody (orb331140) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055461

Preservative

Lyophilized powder

AA Sequence

ELIQERTKGNKSSYHRLSELVEHVFPLLSKEQNSAFPCPEFSSFCYWRDP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HMGCS2 Rabbit Polyclonal Antibody (BF647)
orb2413876 100 µL

HMGCS2 Rabbit Polyclonal Antibody (BF647)

Sign In for Pricing
View Details
OGT inhibitor 4a
T88438-01 1 mg

OGT inhibitor 4a

Sign In for Pricing
View Details
OGT inhibitor 4a
T88438-02 5 mg

OGT inhibitor 4a

Sign In for Pricing
View Details
OGT inhibitor 4a
T88438-03 10 mg

OGT inhibitor 4a

Sign In for Pricing
View Details
OGT inhibitor 4a
T88438-04 25 mg

OGT inhibitor 4a

Sign In for Pricing
View Details
OGT inhibitor 4a
T88438-05 50 mg

OGT inhibitor 4a

Sign In for Pricing
View Details