Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LPL Peptide - C-terminal region

LPL Peptide - C-terminal region

Product Specifications

Product Name Alternative

HDLCQ11, LIPD

UniProt

P06858

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LPL Rabbit Polyclonal Antibody (orb584631) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000228

Preservative

Lyophilized powder

AA Sequence

LGYEINKVRAKRSSKMYLKTRSQMPYKVFHYQVKIHFSGTESETHTNQAF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-NB51 Antibody, Affinity Purified
A300-187 A-T 10 µg

Rabbit anti-NB51 Antibody, Affinity Purified

Sign In for Pricing
View Details
NARF ORF Vector (Human) (pORF)
ORF006898 1.0 µg DNA

NARF ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Cdh7 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K4138704 1.0 µg DNA

Cdh7 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
2-Hydroxyacetophenone (Standard)
HY-W002198R-01 25 mg

2-Hydroxyacetophenone (Standard)

Sign In for Pricing
View Details
2-Hydroxyacetophenone (Standard)
HY-W002198R-02 50 mg

2-Hydroxyacetophenone (Standard)

Sign In for Pricing
View Details
2-Hydroxyacetophenone (Standard)
HY-W002198R-03 100 mg

2-Hydroxyacetophenone (Standard)

Sign In for Pricing
View Details