Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRAT Peptide - N-terminal region

LRAT Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC33103, LCA14

UniProt

O95237

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LRAT Rabbit Polyclonal Antibody (orb584453) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004735

Preservative

Lyophilized powder

AA Sequence

LEVPRTHLTHYGIYLGDNRVAHMMPDILLALTDDMGRTQKVVSNKRLILG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ANT 1 (PRPF6) Goat Polyclonal Antibody
AP32970PU-N 100 µg

ANT 1 (PRPF6) Goat Polyclonal Antibody

Sign In for Pricing
View Details
SNAP43 (SNAPC1) (Center) Rabbit Polyclonal Antibody
AP53957PU-N 400 µL

SNAP43 (SNAPC1) (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS708067 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
HIST4H4 Rabbit Polyclonal Antibody
AP20245PU-N 100 µg

HIST4H4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
2-Amino-5-isopropylbenzoic acid
TRC-A637498-100MG 100 mg

2-Amino-5-isopropylbenzoic acid

Sign In for Pricing
View Details
MTAP (NM_002451) Human Over-expression Lysate
LY419313 100 µg

MTAP (NM_002451) Human Over-expression Lysate

Sign In for Pricing
View Details