Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRG1 Peptide - N-terminal region

LRG1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

HMFT1766, LRG

UniProt

P02750

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LRG1 Rabbit Polyclonal Antibody (orb581713) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_443204

Preservative

Lyophilized powder

AA Sequence

GVTLSPKDCQVFRSDHGSSISCQPPAEIPGYLPADTVHLAVEFFNLTHLP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IgA Secretory Component (ECM1, Extracellular Matrix Protein 1, Secretory Component p85, URBWD) (BSA & Azide Free) (MaxLight 550)
MBS6215350-01 0.1 mL

IgA Secretory Component (ECM1, Extracellular Matrix Protein 1, Secretory Component p85, URBWD) (BSA & Azide Free) (MaxLight 550)

Sign In for Pricing
View Details
IgA Secretory Component (ECM1, Extracellular Matrix Protein 1, Secretory Component p85, URBWD) (BSA & Azide Free) (MaxLight 550)
MBS6215350-02 5x 0.1 mL

IgA Secretory Component (ECM1, Extracellular Matrix Protein 1, Secretory Component p85, URBWD) (BSA & Azide Free) (MaxLight 550)

Sign In for Pricing
View Details
MASH1/Achaete-scute homolog 1 Rabbit mAb
F3207-100uL*2 2x 100 μL

MASH1/Achaete-scute homolog 1 Rabbit mAb

Sign In for Pricing
View Details
SLC25A31 Antibody - N-terminal region
ARP53805_P050-25UL 25 µL

SLC25A31 Antibody - N-terminal region

Sign In for Pricing
View Details
Phospho-TOP2A (Ser1106) Cell-Based ELISA Kit
CBP1442 1 Kit

Phospho-TOP2A (Ser1106) Cell-Based ELISA Kit

Sign In for Pricing
View Details
CD40L (CD40 Ligand, CD40-L, T-cell Antigen Gp39, TNF-related Activation Protein, TRAP, Tumor Necrosis Factor Ligand Superfamily Member 5, CD154, CD40LG, TNFSF5)
139758 200 µL

CD40L (CD40 Ligand, CD40-L, T-cell Antigen Gp39, TNF-related Activation Protein, TRAP, Tumor Necrosis Factor Ligand Superfamily Member 5, CD154, CD40LG, TNFSF5)

Sign In for Pricing
View Details