Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRG1 Peptide - N-terminal region

LRG1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

HMFT1766, LRG

UniProt

P02750

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LRG1 Rabbit Polyclonal Antibody (orb581713) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_443204

Preservative

Lyophilized powder

AA Sequence

GVTLSPKDCQVFRSDHGSSISCQPPAEIPGYLPADTVHLAVEFFNLTHLP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human GABRB3 knockout cell line
ABC-KH5836 1 Vial

Human GABRB3 knockout cell line

Sign In for Pricing
View Details
APPL1 Antibody
E306369 100 µg - 200 µL

APPL1 Antibody

Sign In for Pricing
View Details
Cmss1 Rat siRNA Oligo Duplex (Locus ID 288176)
SR512974 1 Kit

Cmss1 Rat siRNA Oligo Duplex (Locus ID 288176)

Sign In for Pricing
View Details
Noggin Polyclonal Antibody, PE-Cy5.5 Conjugated
bs-2975R-PE-Cy5.5 100 µL

Noggin Polyclonal Antibody, PE-Cy5.5 Conjugated

Sign In for Pricing
View Details
Recombinant Human ABCF1 Protein, N-His
orb2967594-01 50 µg

Recombinant Human ABCF1 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human ABCF1 Protein, N-His
orb2967594-02 100 µg

Recombinant Human ABCF1 Protein, N-His

Sign In for Pricing
View Details