Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRMP Peptide - C-terminal region

LRMP Peptide - C-terminal region

Product Specifications

Product Name Alternative

JAW1

UniProt

Q12912

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LRMP Rabbit Polyclonal Antibody (orb585217) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006143

Preservative

Lyophilized powder

AA Sequence

SKQSEHRPSLPRFISTYSWADAEEEKCELKTKDDSEPSGEETVERTRKPS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Procyanidin B2
TRC-P755830-5MG 5 mg

Procyanidin B2

Sign In for Pricing
View Details
OR1E2 Human Gene Knockout Kit (CRISPR)
KN415769 1 Kit

OR1E2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
rac Alpha-Ethyl DOPA Hydrobromide
TRC-E917280-25MG 25 mg

rac Alpha-Ethyl DOPA Hydrobromide

Sign In for Pricing
View Details
4,4'-DDE
TRC-D195205-5G 5 g

4,4'-DDE

Sign In for Pricing
View Details
FOLH1 / PSMA (Prostate Epithelial Marker) (FOLH1/2363), CF488A conjugate, 0.1mg/mL
BNC882363-500 1x 500 µL

FOLH1 / PSMA (Prostate Epithelial Marker) (FOLH1/2363), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tofacitinib Impurity P
TRC-T528025-10MG 10 mg

Tofacitinib Impurity P

Sign In for Pricing
View Details