Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRMP Peptide - C-terminal region

LRMP Peptide - C-terminal region

Product Specifications

Product Name Alternative

JAW1

UniProt

Q12912

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LRMP Rabbit Polyclonal Antibody (orb585217) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006143

Preservative

Lyophilized powder

AA Sequence

SKQSEHRPSLPRFISTYSWADAEEEKCELKTKDDSEPSGEETVERTRKPS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Akap2 Mouse Gene Knockout Kit (CRISPR)
KN501068 1 Kit

Akap2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD44v9 (Marker of Tumor Metastasis) (CD44v9/2344R), 0.2mg/mL
BNUB2344-100 1x 100 µL

CD44v9 (Marker of Tumor Metastasis) (CD44v9/2344R), 0.2mg/mL

Sign In for Pricing
View Details
Polystyrene A OH
HA110000.100G 100 g

Polystyrene A OH

Sign In for Pricing
View Details
MIR4446 Human qPCR Primer Pair (MI0016789)
HP300964 200 Reactions

MIR4446 Human qPCR Primer Pair (MI0016789)

Sign In for Pricing
View Details
HB EGF (HBEGF) (Center) Rabbit Polyclonal Antibody
AP52008PU-N 400 µL

HB EGF (HBEGF) (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Thyroid gland
CS709670 5x 5 µm

Tissue FFPE Sections, Thyroid gland

Sign In for Pricing
View Details