Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lrp8 Peptide - middle region

Lrp8 Peptide - middle region

Product Specifications

Product Name Alternative

4932703M08Rik, AA921429, AI848122, Lr8b, apoER2, ApoER2

UniProt

Q924X6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Lrp8 Rabbit Polyclonal Antibody (orb579129) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_444303

Preservative

Lyophilized powder

AA Sequence

AGLNGADRQTLVSDNIEWPNGITLDLLSQRLYWVDSKLHQLSSIDFNGGN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ubr1 (A-5) Alexa Fluor® 488
sc-515753 AF488 200 µg/mL

Ubr1 (A-5) Alexa Fluor® 488

Sign In for Pricing
View Details
Trihexyltetradecylphosphonium bromide
IN-0007-TG-0500 500 g

Trihexyltetradecylphosphonium bromide

Sign In for Pricing
View Details
MAGEC2 Rabbit Polyclonal Antibody (BF750)
orb2397374 100 µL

MAGEC2 Rabbit Polyclonal Antibody (BF750)

Sign In for Pricing
View Details
Trmt12 3'UTR Luciferase Stable Cell Line
TU121153 1.0 mL

Trmt12 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Recombinant Rickettsia felis Bifunctional protein FolD (folD)
MBS1400071-01 0.02 mg (E-Coli)

Recombinant Rickettsia felis Bifunctional protein FolD (folD)

Sign In for Pricing
View Details
Recombinant Rickettsia felis Bifunctional protein FolD (folD)
MBS1400071-02 0.02 mg (Yeast)

Recombinant Rickettsia felis Bifunctional protein FolD (folD)

Sign In for Pricing
View Details