Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lrp8 Peptide - middle region

Lrp8 Peptide - middle region

Product Specifications

Product Name Alternative

4932703M08Rik, AA921429, AI848122, Lr8b, apoER2, ApoER2

UniProt

Q924X6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Lrp8 Rabbit Polyclonal Antibody (orb579129) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_444303

Preservative

Lyophilized powder

AA Sequence

AGLNGADRQTLVSDNIEWPNGITLDLLSQRLYWVDSKLHQLSSIDFNGGN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bim (Phospho-Ser77) Rabbit Polyclonal Antibody
BT-AP00801-01 20 µL

Bim (Phospho-Ser77) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Bim (Phospho-Ser77) Rabbit Polyclonal Antibody
BT-AP00801-02 50 µL

Bim (Phospho-Ser77) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Bim (Phospho-Ser77) Rabbit Polyclonal Antibody
BT-AP00801-03 100 µL

Bim (Phospho-Ser77) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Monoclonal HSF2 Antibody (OTI3E1) [HRP]
NBP2-70948H 0.1 mL

Mouse Monoclonal HSF2 Antibody (OTI3E1) [HRP]

Sign In for Pricing
View Details
Anti-SLC22A4 Antibody Picoband® PE Conjugated
A03032-1-PE 100 µg/Vial

Anti-SLC22A4 Antibody Picoband® PE Conjugated

Sign In for Pricing
View Details
Human free haemoglobin, f-Hb ELISA Kit
YLA2541HU-01 48 Tests

Human free haemoglobin, f-Hb ELISA Kit

Sign In for Pricing
View Details