Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRRC23 Peptide - middle region

LRRC23 Peptide - middle region

Product Specifications

Product Name Alternative

LRPB7

UniProt

Q53EV4

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LRRC23 Rabbit Polyclonal Antibody (orb582095) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_964013

Preservative

Lyophilized powder

AA Sequence

ISLHTVELRGNQLESTLGINLPKLKNLYLAQNMLKKVEGLEDLSNLTTLH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vrk1-set siRNA/shRNA/RNAi Lentivector (Mouse)
50198094 4x 500 ng

Vrk1-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
Sulfaquinoxaline sodium
M16870-01 1 g

Sulfaquinoxaline sodium

Sign In for Pricing
View Details
Sulfaquinoxaline sodium
M16870-02 100 mg

Sulfaquinoxaline sodium

Sign In for Pricing
View Details
Sulfaquinoxaline sodium
M16870-03 200 mg

Sulfaquinoxaline sodium

Sign In for Pricing
View Details
Sulfaquinoxaline sodium
M16870-04 500 mg

Sulfaquinoxaline sodium

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Lymphocyte Cytosolic Protein 2 (LCP2)
MBS2052510-01 0.1 mL

PE-Linked Polyclonal Antibody to Lymphocyte Cytosolic Protein 2 (LCP2)

Sign In for Pricing
View Details