LRRC3 Peptide - middle region
LRRC3 Peptide - middle region
Product Specifications
Product Name Alternative
C21orf102
UniProt
Q9BY71
Field of Research
Neuroscience
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with LRRC3 Rabbit Polyclonal Antibody (orb579601) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_112153
Preservative
Lyophilized powder
AA Sequence
TFAGLAGGLRLLDLSYNRIQRIPKDALGKLSAKIRLSHNPLHCECALQEA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
RC217565L3V 200 µL
PRRG3 (NM_024082) Human Tagged ORF Clone Lentiviral Particle
Sign In for Pricing
View Details 
MBS1137542-01 0.02 mg (E-Coli)
Recombinant Saccharomyces cerevisiae Uncharacterized protein YHR127W (YHR127W)
Sign In for Pricing
View Details MBS1137542-02 0.1 mg (E-Coli)
Recombinant Saccharomyces cerevisiae Uncharacterized protein YHR127W (YHR127W)
Sign In for Pricing
View Details MBS1137542-03 0.02 mg (Yeast)
Recombinant Saccharomyces cerevisiae Uncharacterized protein YHR127W (YHR127W)
Sign In for Pricing
View Details MBS1137542-04 0.1 mg (Yeast)
Recombinant Saccharomyces cerevisiae Uncharacterized protein YHR127W (YHR127W)
Sign In for Pricing
View Details MBS1137542-05 0.02 mg (Baculovirus)
Recombinant Saccharomyces cerevisiae Uncharacterized protein YHR127W (YHR127W)
Sign In for Pricing
View Details