Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRRC3 Peptide - middle region

LRRC3 Peptide - middle region

Product Specifications

Product Name Alternative

C21orf102

UniProt

Q9BY71

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LRRC3 Rabbit Polyclonal Antibody (orb579601) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_112153

Preservative

Lyophilized powder

AA Sequence

TFAGLAGGLRLLDLSYNRIQRIPKDALGKLSAKIRLSHNPLHCECALQEA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Antitumor agent-86
orb1982346-01 5 mg

Antitumor agent-86

Sign In for Pricing
View Details
Antitumor agent-86
orb1982346-02 50 mg

Antitumor agent-86

Sign In for Pricing
View Details
Human hsa-miR-3064-5p miRNA Antagomir
abx886844-01 10 nmol

Human hsa-miR-3064-5p miRNA Antagomir

Sign In for Pricing
View Details
Human hsa-miR-3064-5p miRNA Antagomir
abx886844-02 20 nmol

Human hsa-miR-3064-5p miRNA Antagomir

Sign In for Pricing
View Details
Echdc2 (NM_026728) Mouse Tagged ORF Clone
MG203081 10 µg

Echdc2 (NM_026728) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Thermometres, Mercury, White Back
2013720/3 1 Each

Thermometres, Mercury, White Back

Sign In for Pricing
View Details