Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRRC52 Peptide - N-terminal region

LRRC52 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ25811

UniProt

Q8N7C0

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LRRC52 Rabbit Polyclonal Antibody (orb579189) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001005214

Preservative

Lyophilized powder

AA Sequence

QEVICTGKQLTEYPLDIPLNTRRLFLNENRITSLPAMHLGLLSDLVYLDC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IL12B protein
orb604185-01 20 µg

Human IL12B protein

Sign In for Pricing
View Details
Human IL12B protein
orb604185-02 100 µg

Human IL12B protein

Sign In for Pricing
View Details
Human IL12B protein
orb604185-03 1 mg

Human IL12B protein

Sign In for Pricing
View Details
Mouse Nfe2l3 activation kit by CRISPRa
GA202877 1 Kit

Mouse Nfe2l3 activation kit by CRISPRa

Sign In for Pricing
View Details
Cytokeratin 10 Antibody (YA7517, Rabbit)
HY-P87832 1 Each

Cytokeratin 10 Antibody (YA7517, Rabbit)

Sign In for Pricing
View Details
α-Glucosidase from bacillus stearothermophilus, lyophilized powder, 250 Units
EG182412 1 PC

α-Glucosidase from bacillus stearothermophilus, lyophilized powder, 250 Units

Sign In for Pricing
View Details