Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRRC52 Peptide - N-terminal region

LRRC52 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ25811

UniProt

Q8N7C0

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LRRC52 Rabbit Polyclonal Antibody (orb579189) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001005214

Preservative

Lyophilized powder

AA Sequence

QEVICTGKQLTEYPLDIPLNTRRLFLNENRITSLPAMHLGLLSDLVYLDC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HIST3H3, ID (HIST3H3, H3FT, Histone H3.1t, H3/g) (MaxLight 490) discontinued
036606-ML490 100 µL

HIST3H3, ID (HIST3H3, H3FT, Histone H3.1t, H3/g) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Recombinant Protein Tyrosine Phosphatase Receptor Type A (PTPRA)
SIPD153Hu01-01 10 µg

Recombinant Protein Tyrosine Phosphatase Receptor Type A (PTPRA)

Sign In for Pricing
View Details
Recombinant Protein Tyrosine Phosphatase Receptor Type A (PTPRA)
SIPD153Hu01-02 50 µg

Recombinant Protein Tyrosine Phosphatase Receptor Type A (PTPRA)

Sign In for Pricing
View Details
Recombinant Protein Tyrosine Phosphatase Receptor Type A (PTPRA)
SIPD153Hu01-03 200 µg

Recombinant Protein Tyrosine Phosphatase Receptor Type A (PTPRA)

Sign In for Pricing
View Details
Recombinant Protein Tyrosine Phosphatase Receptor Type A (PTPRA)
SIPD153Hu01-04 1 mg

Recombinant Protein Tyrosine Phosphatase Receptor Type A (PTPRA)

Sign In for Pricing
View Details
Recombinant Protein Tyrosine Phosphatase Receptor Type A (PTPRA)
SIPD153Hu01-05 5 mg

Recombinant Protein Tyrosine Phosphatase Receptor Type A (PTPRA)

Sign In for Pricing
View Details