Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lrrfip1 Peptide - C-terminal region

Lrrfip1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

AU024550, Fliiap1

UniProt

Q3UZ39

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Lrrfip1 Rabbit Polyclonal Antibody (orb581146) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_032541

Preservative

Lyophilized powder

AA Sequence

NGTDAHVMDLQRDANRQISDLKFKLAKSEQEITALEQNVIRLESQVTRYR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Isopropyl 2-amino-5-isopropylthiophene-3-carboxylate
sc-327994 500 mg

Isopropyl 2-amino-5-isopropylthiophene-3-carboxylate

Sign In for Pricing
View Details
Anti-Alpha-synuclein Antibody
CPA2089-01 30 µL

Anti-Alpha-synuclein Antibody

Sign In for Pricing
View Details
Anti-Alpha-synuclein Antibody
CPA2089-02 50 μL

Anti-Alpha-synuclein Antibody

Sign In for Pricing
View Details
Anti-Alpha-synuclein Antibody
CPA2089-03 100 µL

Anti-Alpha-synuclein Antibody

Sign In for Pricing
View Details
Anti-Alpha-synuclein Antibody
CPA2089-04 200 µL

Anti-Alpha-synuclein Antibody

Sign In for Pricing
View Details
C19orf48 Rabbit Polyclonal Antibody (BF750)
orb2521353 100 µL

C19orf48 Rabbit Polyclonal Antibody (BF750)

Sign In for Pricing
View Details