Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lrrfip1 Peptide - C-terminal region

Lrrfip1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

AU024550, Fliiap1

UniProt

Q3UZ39

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Lrrfip1 Rabbit Polyclonal Antibody (orb581146) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_032541

Preservative

Lyophilized powder

AA Sequence

NGTDAHVMDLQRDANRQISDLKFKLAKSEQEITALEQNVIRLESQVTRYR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCMV-PKLR (human) -HA-Neo
BZ61059 1 Vial

PCMV-PKLR (human) -HA-Neo

Sign In for Pricing
View Details
Human anti-human CD146 mAb
E4A09C47-100 100 µg

Human anti-human CD146 mAb

Sign In for Pricing
View Details
CDK11 Rabbit Polyclonal Antibody (PerCP)
orb1815307 100 µL

CDK11 Rabbit Polyclonal Antibody (PerCP)

Sign In for Pricing
View Details
GNB1 Rabbit Polyclonal Antibody (HRP)
orb2106341 100 µL

GNB1 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Bepristat 1a
orb2815747-01 50 mg

Bepristat 1a

Sign In for Pricing
View Details
Bepristat 1a
orb2815747-02 10 mg

Bepristat 1a

Sign In for Pricing
View Details