Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LSM8 Peptide - N-terminal region

LSM8 Peptide - N-terminal region

Product Specifications

Product Name Alternative

NAA38

UniProt

O95777

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LSM8 Rabbit Polyclonal Antibody (orb577796) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057284

Preservative

Lyophilized powder

AA Sequence

MTSALENYINRTVAVITSDGRMIVGTLKGFDQTINLILDESHERVFSSSQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HA Protein (C-His, Influenza B)
P520294 100 µg

HA Protein (C-His, Influenza B)

Sign In for Pricing
View Details
Symplekin (SYMPK) Antibody
abx124196-01 20 µL

Symplekin (SYMPK) Antibody

Sign In for Pricing
View Details
Symplekin (SYMPK) Antibody
abx124196-02 100 µL

Symplekin (SYMPK) Antibody

Sign In for Pricing
View Details
Symplekin (SYMPK) Antibody
abx124196-03 2x 100 µL

Symplekin (SYMPK) Antibody

Sign In for Pricing
View Details
NIPA (ZC3HC1) (NM_016478) Human Over-expression Lysate
LS051530-20ug 20 µg

NIPA (ZC3HC1) (NM_016478) Human Over-expression Lysate

Sign In for Pricing
View Details
Nori® Equine CRP POCT Systems-25 Tests
GR223008 25 Tests

Nori® Equine CRP POCT Systems-25 Tests

Sign In for Pricing
View Details