Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LSM8 Peptide - N-terminal region

LSM8 Peptide - N-terminal region

Product Specifications

Product Name Alternative

NAA38

UniProt

O95777

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LSM8 Rabbit Polyclonal Antibody (orb577796) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057284

Preservative

Lyophilized powder

AA Sequence

MTSALENYINRTVAVITSDGRMIVGTLKGFDQTINLILDESHERVFSSSQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zdhhc1 Rat shRNA Lentiviral Particle (Locus ID 291967)
TL703624V 500 µL Each

Zdhhc1 Rat shRNA Lentiviral Particle (Locus ID 291967)

Sign In for Pricing
View Details
A-RAF Recombinant Antibody, AbBy Fluor™ 350 Conjugated
bsm-52015R-BF350 100 µL

A-RAF Recombinant Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
Recombinant Pig Transmembrane protein 14A (TMEM14A)
MBS950677 Inquire

Recombinant Pig Transmembrane protein 14A (TMEM14A)

Sign In for Pricing
View Details
Germinal Center Kinase Rabbit Polyclonal Antibody (Cy5)
orb944734 100 µL

Germinal Center Kinase Rabbit Polyclonal Antibody (Cy5)

Sign In for Pricing
View Details
Anti-JAK3 Antibody Picoband®, Dylight550 Conjugate
A02598-3-Dylight550 100 µg

Anti-JAK3 Antibody Picoband®, Dylight550 Conjugate

Sign In for Pricing
View Details
AID Polyclonal Conjugated Antibody
MBS9450397-01 0.1 mL (Biotin)

AID Polyclonal Conjugated Antibody

Sign In for Pricing
View Details