Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LTA4H Peptide - N-terminal region

LTA4H Peptide - N-terminal region

Product Specifications

UniProt

P09960

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LTA4H Rabbit Polyclonal Antibody (orb582305) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000886

Preservative

Lyophilized powder

AA Sequence

IVIEISFETSPKSSALQWLTPEQTSGKEHPYLFSQCQAIHCRAILPCQDT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rhodopseudomonas palustris Chaperone protein htpG (htpG), partial
MBS1349834 Inquire

Recombinant Rhodopseudomonas palustris Chaperone protein htpG (htpG), partial

Sign In for Pricing
View Details
GRHL3 (NM_198174) Human Recombinant Protein
TP307857M 100 µg

GRHL3 (NM_198174) Human Recombinant Protein

Sign In for Pricing
View Details
FA2H Polyclonal Antibody
E913873 100 µL

FA2H Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Mycobacterium Abscessus MAB_4928c Protein (aa 1-208)
VAng-Yyj5484-1mgEcoli 1 mg (E. coli)

Recombinant Mycobacterium Abscessus MAB_4928c Protein (aa 1-208)

Sign In for Pricing
View Details
Lentiviral human UBIAD1 shRNA (UAS) - Lentiviral human UBIAD1 shRNA (UAS, GFP) plasmid
GTR15314257 1 Vial

Lentiviral human UBIAD1 shRNA (UAS) - Lentiviral human UBIAD1 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Lcn10 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K3281708 1.0 µg DNA

Lcn10 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details