LTA4H Peptide - N-terminal region
LTA4H Peptide - N-terminal region
Product Specifications
UniProt
P09960
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with LTA4H Rabbit Polyclonal Antibody (orb582305) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_000886
Preservative
Lyophilized powder
AA Sequence
IVIEISFETSPKSSALQWLTPEQTSGKEHPYLFSQCQAIHCRAILPCQDT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MR205280L4V 200 µL
Gpd1 (NM_010271) Mouse Tagged ORF Clone Lentiviral Particle
Sign In for Pricing
View Details 
104801G0-AAT 25 Tests
APC/iFluor® 750 Anti-non-human primates/ human CD48 Antibody *MEM-102*
Sign In for Pricing
View Details 
D2794 96 Tests
Eukaryotic translation initiation Factor 3 subunit H (EIF3H) Human ELISA Kit
Sign In for Pricing
View Details