Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LTB Peptide - N-terminal region

LTB Peptide - N-terminal region

Product Specifications

Product Name Alternative

TNFC, TNFSF3, p33

UniProt

Q06643

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LTB Rabbit Polyclonal Antibody (orb330406) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002332

Preservative

Lyophilized powder

AA Sequence

AVPITVLAVLALVPQDQGGLVTETADPGAQAQQGLGFQKLPEEEPETDLS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IGFBP4 ELISA Kit (Cattle) (OKCD02621)
OKCD02621 96 Well

IGFBP4 ELISA Kit (Cattle) (OKCD02621)

Sign In for Pricing
View Details
Human CSF2 protein (Active)
orb359028-01 5 µg

Human CSF2 protein (Active)

Sign In for Pricing
View Details
Human CSF2 protein (Active)
orb359028-02 100 µg

Human CSF2 protein (Active)

Sign In for Pricing
View Details
Human CSF2 protein (Active)
orb359028-03 500 µg

Human CSF2 protein (Active)

Sign In for Pricing
View Details
Nalfurafine Impurity 36
RM-N012136-01 10 mg

Nalfurafine Impurity 36

Sign In for Pricing
View Details
Nalfurafine Impurity 36
RM-N012136-02 25 mg

Nalfurafine Impurity 36

Sign In for Pricing
View Details