Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LTK Peptide - N-terminal region

LTK Peptide - N-terminal region

Product Specifications

Product Name Alternative

TYK1

UniProt

P29376

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LTK Rabbit Polyclonal Antibody (orb584633) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002335

Preservative

Lyophilized powder

AA Sequence

GGGGRAYLRPRDRGRTQASPEKLENRSEAPGSGGRGGAAGGGGGWTSRAP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Saccharomyces Cerevisiae CDC34 Protein (aa 1-295) [His]
VAng-Wyb4382-1mg 1 mg

Recombinant Saccharomyces Cerevisiae CDC34 Protein (aa 1-295) [His]

Sign In for Pricing
View Details
MYO10 Antibody, FITC conjugated
A70300-50UG 50 µg

MYO10 Antibody, FITC conjugated

Sign In for Pricing
View Details
TLR1 Rabbit Polyclonal Antibody
E53P11435 100 µL

TLR1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Influenza B (matrix protein M1) Antibody
orb23405 1 mg

Influenza B (matrix protein M1) Antibody

Sign In for Pricing
View Details
Swine IL-1 alpha ELISpot
SPOT2542S 1 Set

Swine IL-1 alpha ELISpot

Sign In for Pricing
View Details
Olr1408-set siRNA/shRNA/RNAi Lentivector (Rat)
33913096 4x 500 ng

Olr1408-set siRNA/shRNA/RNAi Lentivector (Rat)

Sign In for Pricing
View Details