Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LTK Peptide - N-terminal region

LTK Peptide - N-terminal region

Product Specifications

Product Name Alternative

TYK1

UniProt

P29376

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LTK Rabbit Polyclonal Antibody (orb584633) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002335

Preservative

Lyophilized powder

AA Sequence

GGGGRAYLRPRDRGRTQASPEKLENRSEAPGSGGRGGAAGGGGGWTSRAP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal SPINK2 Antibody [Biotin]
NBP2-98568B 0.1 mL

Rabbit Polyclonal SPINK2 Antibody [Biotin]

Sign In for Pricing
View Details
MIR4706 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV770009 1.0 µg DNA

MIR4706 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Recombinant Mouse IL1RAP Protein, N-His
E55P8072 50 µg

Recombinant Mouse IL1RAP Protein, N-His

Sign In for Pricing
View Details
Recombinant Clostridium perfringens tRNA pseudouridine synthase B (truB)
MBS1366470-01 0.02 mg (E-Coli)

Recombinant Clostridium perfringens tRNA pseudouridine synthase B (truB)

Sign In for Pricing
View Details
Recombinant Clostridium perfringens tRNA pseudouridine synthase B (truB)
MBS1366470-02 0.02 mg (Yeast)

Recombinant Clostridium perfringens tRNA pseudouridine synthase B (truB)

Sign In for Pricing
View Details
Recombinant Clostridium perfringens tRNA pseudouridine synthase B (truB)
MBS1366470-03 0.1 mg (E-Coli)

Recombinant Clostridium perfringens tRNA pseudouridine synthase B (truB)

Sign In for Pricing
View Details