LUC7L Peptide - N-terminal region
LUC7L Peptide - N-terminal region
Product Specifications
Product Name Alternative
FLJ10231, LUC7-LIKE, LUC7B1, SR+89, Luc7, hLuc7B1
UniProt
Q9NQ29
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with LUC7L Rabbit Polyclonal Antibody (orb583724) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_958815
Preservative
Lyophilized powder
AA Sequence
YEIASKERDLFFELDAMDHLESFIAECDRRTELAKKRLAETQEEISAEVS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
H6100-55-PE 200 µL
HLA Class 2 Antigen DRB1, NT (HLA Class II Histocompatibility Antigen DRB1-1 beta Chain, HLA-DR1B, HLA-DRB1, HLA-DRB1*, HLA-DRB, DR1, DR-1, DRB1, DRw10, FLJ75017, FLJ76359, MHC Class II Antigen DRB1*1, SS1) (PE) discontinued
Sign In for Pricing
View Details 
MBS6233357-01 0.1 mL
ID1 (Inhibitor of DNA Binding 1, ID, Class B Basic Helix-loop-helix Protein 24, bHLHb24, DNA Binding Protein Inhibitor ID-1) (MaxLight 750)
Sign In for Pricing
View Details MBS6233357-02 5x 0.1 mL
ID1 (Inhibitor of DNA Binding 1, ID, Class B Basic Helix-loop-helix Protein 24, bHLHb24, DNA Binding Protein Inhibitor ID-1) (MaxLight 750)
Sign In for Pricing
View Details