Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LUC7L Peptide - N-terminal region

LUC7L Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ10231, LUC7-LIKE, LUC7B1, SR+89, Luc7, hLuc7B1

UniProt

Q9NQ29

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LUC7L Rabbit Polyclonal Antibody (orb583724) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_958815

Preservative

Lyophilized powder

AA Sequence

YEIASKERDLFFELDAMDHLESFIAECDRRTELAKKRLAETQEEISAEVS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Discoidin Domain-Containing Receptor 2 (DDR2) Antibody
abx461588-01 100 µg

Discoidin Domain-Containing Receptor 2 (DDR2) Antibody

Sign In for Pricing
View Details
Discoidin Domain-Containing Receptor 2 (DDR2) Antibody
abx461588-02 1 mg

Discoidin Domain-Containing Receptor 2 (DDR2) Antibody

Sign In for Pricing
View Details
NRF1 Rabbit pAb
E45R25905N-50 50 µL

NRF1 Rabbit pAb

Sign In for Pricing
View Details
CPLX1 Rabbit Polyclonal Antibody
BT-AP08310-01 20 µL

CPLX1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CPLX1 Rabbit Polyclonal Antibody
BT-AP08310-02 50 µL

CPLX1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CPLX1 Rabbit Polyclonal Antibody
BT-AP08310-03 100 µL

CPLX1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details