Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LUC7L Peptide - middle region

LUC7L Peptide - middle region

Product Specifications

Product Name Alternative

FLJ10231, LUC7-LIKE, LUC7B1, Luc7, SR+89, hLuc7B1

UniProt

Q1W6G4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LUC7L Rabbit Polyclonal Antibody (orb583725) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060502

Preservative

Lyophilized powder

AA Sequence

EEIGKLLAKAEQLGAEGNVDESQKILMEVEKVRAKKKEAEEEYRNSMPAS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LentimiRa-hsa-miR-302a Vector
mh41115 500 ng

LentimiRa-hsa-miR-302a Vector

Sign In for Pricing
View Details
Recombinant Mouse Lysozyme C-2 (Lyz2)
MBS1022200-01 0.02 mg (E-Coli)

Recombinant Mouse Lysozyme C-2 (Lyz2)

Sign In for Pricing
View Details
Recombinant Mouse Lysozyme C-2 (Lyz2)
MBS1022200-02 0.02 mg (Yeast)

Recombinant Mouse Lysozyme C-2 (Lyz2)

Sign In for Pricing
View Details
Recombinant Mouse Lysozyme C-2 (Lyz2)
MBS1022200-03 0.1 mg (E-Coli)

Recombinant Mouse Lysozyme C-2 (Lyz2)

Sign In for Pricing
View Details
Recombinant Mouse Lysozyme C-2 (Lyz2)
MBS1022200-04 0.1 mg (Yeast)

Recombinant Mouse Lysozyme C-2 (Lyz2)

Sign In for Pricing
View Details
Recombinant Mouse Lysozyme C-2 (Lyz2)
MBS1022200-05 1 mg (E-Coli)

Recombinant Mouse Lysozyme C-2 (Lyz2)

Sign In for Pricing
View Details