Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LUC7L Peptide - middle region

LUC7L Peptide - middle region

Product Specifications

Product Name Alternative

FLJ10231, LUC7-LIKE, LUC7B1, Luc7, SR+89, hLuc7B1

UniProt

Q1W6G4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LUC7L Rabbit Polyclonal Antibody (orb583725) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060502

Preservative

Lyophilized powder

AA Sequence

EEIGKLLAKAEQLGAEGNVDESQKILMEVEKVRAKKKEAEEEYRNSMPAS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Pfkfb4 Pre-designed siRNA Set B
SI210341B 1 Each

Rat Pfkfb4 Pre-designed siRNA Set B

Sign In for Pricing
View Details
IgG, H&L (Texas Red)
I1903-36Z 2 mg

IgG, H&L (Texas Red)

Sign In for Pricing
View Details
WHAMMP1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV755960 1.0 µg DNA

WHAMMP1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Regan- Lowe Semisolid TransportMedium Base
M2193-500G 500 g

Regan- Lowe Semisolid TransportMedium Base

Sign In for Pricing
View Details
TPO Antibody
orb751000-01 20 µg

TPO Antibody

Sign In for Pricing
View Details
TPO Antibody
orb751000-02 100 µg

TPO Antibody

Sign In for Pricing
View Details